llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com Report : Visit Site

Technical data of the llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com

Geo IP provides you such as latitude, longitude and ISP (Internet Service Provider) etc. informations. Our GeoIP service found where is host llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com. Currently, hosted in United Kingdom and its service provider is Iomart .

the related websites

llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.co.uk anglesey-history.co.uk sickipedia.org angleseymodelvillage.co.uk ft.com laterooms.com aukweb.net walkwithwonder.co.uk de.com uk.com bb-online.com matchtable.com easynet.com filecrop.com heartinternet.uk ifastnet.com m247.com ufindus.com 

HTTP Header Analysis

HTTP Header information is a part of HTTP protocol that a user's browser sends to called Apache/2.0.52 (CentOS) containing the details of what the browser wants and will accept back from the web server.

DNS

HtmlToText

llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com is the longest single word (without hyphens) dot com domain name in the world . it was registered by internetters on 21st october 1999. this welsh town actually exists and its name translates as "the church of st. mary in the hollow of white hazel trees near the rapid whirlpool by st. tysilio's of the red cave". for brevity, it is understandable that many of the locals simply refer to their village as " llanfair " which, of course, makes for easier typing and is faster to pronounce. prior to october 1999 it was not possible to register dot com domain names longer than 26 characters (including 4 for the dot com suffix). this denied many businesses and organisations the ability to register their full trading names as a dot com domain name, however in october 1999 it became possible to register domain names up to 67 characters in length (including the 4 for the dot com suffix). companies with names such as cheltenham and gloucester were then able to secure their trading names with a dot com suffix www.cheltenhamandgloucester.com (27 characters). click here for more information about places of interest or associated with llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch. there is a station in wales called gorsafawddachaidraigodanheddogleddollonpenrhynareurdraethceredigion but this is well less known. sadly even the 67 character allowance for a dot com domain name is still insufficient for the town of tetaumatawhakatangihangakoauaotamateaurehaeaturipukapihimaungahoronukupokaiwhenuaakitanarahu in new zealand with a staggering 92 characters however even this seems positively tiny compared to the town of krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphop nopparatrajathaniburiromudomrajaniwesmahasatharn amornphimarnavatarnsathitsakkattiyavisanukamprasit in thailand which is a whopping 163 characters long so long that it doesn't even fit on one line! however whilst the new zealand place name is recognised by the guiness book of record, the thailand name is not. other long names (but not place names) include words such as pneumonoultramicroscopicsilicovolcanokoniosis (and many others) . © copyright internetters limited 1998-2013. all rights reserved internetters domain name registration and web hosting specialists since 1998

URL analysis for llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com

http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/information-about-tetaumatawhakatang.htm
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/information-about-krungthepmaha.htm
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/information-about-llanfair.htm
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/very-long-names.htm
http://www.llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com/information-about-gorsafawdd.htm
internetters.co.uk

Whois Information

Whois is a protocol that is access to registering information. You can reach when the website was registered, when it will be expire, what is contact details of the site with the following informations. In a nutshell, it includes these informations;

Domain Name: LLANFAIRPWLLGWYNGYLLGOGERYCHWYRNDROBWLLLLANTYSILIOGOGOGOCH.COM
Registry Domain ID: 11531399_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.easyspace.com
Registrar URL: http://www.easyspace.com
Updated Date: 2017-05-30T14:06:45Z
Creation Date: 1999-10-20T22:57:00Z
Registry Expiry Date: 2017-10-20T22:57:00Z
Registrar: EASYSPACE LTD.
Registrar IANA ID: 79
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +44.3707555066
Domain Status: ok https://icann.org/epp#ok
Name Server: HEBE.IOMART.COM
Name Server: HERACLES.IOMART.COM
Name Server: IPHICLES.IOMART.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2017-08-24T13:47:14Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

NOTICE: The expiration date displayed in this record is the date the
registrar's sponsorship of the domain name registration in the registry is
currently set to expire. This date does not necessarily reflect the expiration
date of the domain name registrant's agreement with the sponsoring
registrar. Users may consult the sponsoring registrar's Whois database to
view the registrar's reported date of expiration for this registration.

TERMS OF USE: You are not authorized to access or query our Whois
database through the use of electronic processes that are high-volume and
automated except as reasonably necessary to register domain names or
modify existing registrations; the Data in VeriSign Global Registry
Services' ("VeriSign") Whois database is provided by VeriSign for
information purposes only, and to assist persons in obtaining information
about or related to a domain name registration record. VeriSign does not
guarantee its accuracy. By submitting a Whois query, you agree to abide
by the following terms of use: You agree that you may use this Data only
for lawful purposes and that under no circumstances will you use this Data
to: (1) allow, enable, or otherwise support the transmission of mass
unsolicited, commercial advertising or solicitations via e-mail, telephone,
or facsimile; or (2) enable high volume, automated, electronic processes
that apply to VeriSign (or its computer systems). The compilation,
repackaging, dissemination or other use of this Data is expressly
prohibited without the prior written consent of VeriSign. You agree not to
use electronic processes that are automated and high-volume to access or
query the Whois database except as reasonably necessary to register
domain names or modify existing registrations. VeriSign reserves the right
to restrict your access to the Whois database in its sole discretion to ensure
operational stability. VeriSign may restrict or terminate your access to the
Whois database for failure to abide by these terms of use. VeriSign
reserves the right to modify these terms at any time.

The Registry database contains ONLY .COM, .NET, .EDU domains and
Registrars.

  REGISTRAR EASYSPACE LTD.

SERVERS

  SERVER com.whois-servers.net

  ARGS domain =llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com

  PORT 43

  TYPE domain

DOMAIN

  NAME llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch.com

  CHANGED 2017-05-30

  CREATED 1999-10-20

STATUS
ok https://icann.org/epp#ok

NSERVER

  HEBE.IOMART.COM 50.97.43.3

  HERACLES.IOMART.COM 62.128.193.135

  IPHICLES.IOMART.COM 84.22.161.172

  REGISTERED yes

Mistakes

The following list shows you to spelling mistakes possible of the internet users for the website searched .